Recombinant Human Pregnancy-Specific β-1-Glycoprotein 2/PSG2

Instruction Manual!

Product name:	Recombinant Human Pregnancy-Specific β-1-Glycoprotein 2/PSG2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Pregnancy-specific beta-1-glycoprotein 2 is produced by our Mammalian expression system and the target gene encoding Gln35-Thr335 is expressed with a 6His tag at the C-terminus.
Names	Pregnancy specific beta-1-glycoprotein 2, PSBG2, Pregnancy-specific beta-1 glycoprotein E, pregnancy-specific beta-1-glycoprotein 2, pregnancy-specific beta-1-glycoprotein 7, PSG2
Accession #	P11465
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QVTIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDLYHYITSYVVDGQIIIYGPAYSGRE TAYSNASLLIQNVTREDAGSYTLHIIKRGDGTRGVTGYFTFTLYLETPKPSISSSNLNPREAMET VILTCDPETPDTSYQWWMNGQSLPMTHRFQLSETNRTLFLFGVTKYTAGPYECEIRNSGSASRSD PVTLNLLHGPDLPRIHPSYTNYRSGDNLYLSCFANSNPPAQYSWTINGKFQQSGQNLFIPQITTK HSGLYVCSVRNSATGEESSTSLTVKVSASTRIGLLPLLNPTVDHHHHHH
Background	PSG2 is a secreted protein that in humans is encoded by the PSG2 gene. It is a member of the human pregnancy-specific glycoproteins (PSGs) family. These proteins are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. PSG2 consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. It has an arg-gly-asp (RGD) motif, which has been shown to function as an adhesion recognition signal for several integrins, in the N-terminal domain.