elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human TRAIL/TNFSF10/CD253

Recombinant Human TRAIL/TNFSF10/CD253 Recombinant Human TRAIL/TNFSF10/CD253

Instruction Manual!

Product name: Recombinant Human TRAIL/TNFSF10/CD253
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human TNF-related Apoptosis-inducing Ligand is produced by our E.coli expression system and the target gene encoding Val114-Gly281 is expressed with a 6His tag at the C-terminus.
Names Tumor Necrosis Factor Ligand Superfamily Member 10, Apo-2 Ligand, Apo-2L, TNF-Related Apoptosis-Inducing Ligand, Protein TRAIL, CD253, TNFSF10, APO2L, TRAIL
Accession # P50591
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIH EKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSI YQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVGLEHHHHHH
Background Human TNFSF10 is a type II transmembrane protein with an intracellular N-terminus and a ‘TNF homology domain’ (THD) at the extracellular C terminus. TNFSF10 can interact with several distinct receptors. Two of these receptors that belongs to TNFR superfamily, DR4 (TRAIL-R1) and DR5 (TRAIL-R2/TRICK2), are plasma membrane proteins containing intracellular death domains essential for activating apoptosis. TNFSF10 is promising for cancer therapy because it is cytotoxic and activates apoptosis in the majority of malignant cells, but not in normal cells.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese