elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human CaM Kinase ID/CAMK1D

Recombinant Human CaM Kinase ID/CAMK1D Recombinant Human CaM Kinase ID/CAMK1D

Instruction Manual!

Product name: Recombinant Human CaM Kinase ID/CAMK1D
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human CaM kinase ID is produced by our E.coli expression system and the target gene encoding Met1-Lys385 is expressed with a GST tag at the N-terminus.
Names Calcium/calmodulin-dependent protein kinase type 1D, CaM kinase I delta, CaMKI-like protein kinase, CAMK1D.CAMK1D, CaMK1 delta,
Accession # Q8IU85
Formulation Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMARENGESSSSWKKQAEDIKKIFEFKETLGTGAF SEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQ LVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMIS DFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKL FEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVS AQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISS SSGVSGVGAERRPRPTTVTAVHSGSK
Background CAMK1D is a serine?threonine kinase that is a member of the calcium?calmodulin-dependent protein kinase family. It contains a protein kinase domain. CAMK1D expressed in polymorphonuclear leukocytes and may be part of the chemokine signal transduction pathway that regulates granulocyte function. It may also be involved in modulation of neuronal apoptosis. It activates CREB-dependent gene transcription, regulates calcium-mediated granulocyte function and respiratory burst and promotes basal dendritic growth of hippocampal neurons.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese