Recombinant Human Eukaryotic Translation Initiation Factor 5A-2/EIF5A2

Instruction Manual!

Product name:	Recombinant Human Eukaryotic Translation Initiation Factor 5A-2/EIF5A2
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human EIF5A2 is produced by our E.coli expression system and the target gene encoding Met1-Lys153 is expressed with a 6His tag at the N-terminus.
Names	Eukaryotic translation initiation factor 5A-2, Eukaryotic initiation factor 5A isoform 2, EIF5A2
Accession #	Q9GZV4
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMST SKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVRE DLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Background	EIF5A2 is a member of the eIF-5A family. It is a 153 amino acids protein that in humans is encoded by the EIF5A2 gene. EIF5A2 is expressed in ovarian and colorectal cancer cell lines and highly expressed in testis.It has an important function at the level of mRNA turnover and mediates effects of polyamines on neuronal process extension and survival. It plays an important role in brain development and function, and in skeletal muscle stem cell differentiation.