Recombinant Human Calcitonin Gene-Related Peptide 2/CALCB

Instruction Manual!

Product name:	Recombinant Human Calcitonin Gene-Related Peptide 2/CALCB
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of PBS, pH 7.4, 50% glycerol.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human CALCB is produced by our E.coli expression system and the target gene encoding Met1-Ala127 is expressed with a GST tag at the N-terminus.
Names	Calcitonin gene-related peptide 2, CALC2, Beta-type CGRP, Calcitonin gene-related peptide II, CALCB.
Accession #	P10092
Formulation	Supplied as a 0.2 μm filtered solution of PBS, pH 7.4, 50% glycerol.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMGFRKFSPFLALSILVLYQAGSLQAA PFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTH RLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA
Background	CALCB is a member of the calcitonin family. CALCB is produced in both peripheral and central neurons. It is a potent peptide vasodilator and can function in the transmission of pain. In the spinal cord, the function and expression of CGRP may differ depending on the location of synthesis. CALCB is derived mainly from the cell bodies of motor neurons when synthesized in the ventral horn of the spinal cord and may contribute to the regeneration of nervous tissue after injury.