Recombinant Human Tryptophan--tRNA Ligase, Cytoplasmic/WARS/TrpRS

Instruction Manual!

Product name:	Recombinant Human Tryptophan--tRNA Ligase, Cytoplasmic/WARS/TrpRS
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human TrpRS is produced by our E.coli expression system and the target gene encoding Met1-Gln471 is expressed with a 6His tag at the N-terminus.
Names	WARS also known as Tryptophanyl-tRNA synthetase, Interferon-induced protein 53.
Accession #	P23381
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVS LKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSS KIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLI PFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDY MGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQC LIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKT KVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALI EVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
Background	There exists two types of tryptophanyl tRNA synthetases, the cytoplasmic form called WARS, the mitochondrial form called WARS2. WARS catalyzes the aminoacylation of tRNA (trp) with tryptophan and is induced by interferon. WARS regulates ERK, Akt, eNOS activation pathway, which are related with angiogenesis, cytoskelatal reorganization and shear stess-reponsive gene expression.