elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human IL-18 Receptor Accessory Protein/IL-18RAcP/IL-1R7

Recombinant Human IL-18 Receptor Accessory Protein/IL-18RAcP/IL-1R7 Recombinant Human IL-18 Receptor Accessory Protein/IL-18RAcP/IL-1R7

Instruction Manual!

Product name: Recombinant Human IL-18 Receptor Accessory Protein/IL-18RAcP/IL-1R7
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human IL-18RAcP is produced by our Mammalian expression system and the target gene encoding Phe20-Arg356 is expressed with a 6His tag at the C-terminus.
Names Interleukin-18 receptor accessory protein (IL18RAP), Accessory protein-like, CD218 antigen-like family member B, CDw218b, IL-1R accessory protein-like, Interleukin-1 receptor 7, Interleukin-18 receptor accessory protein-like, Interleukin-18 receptor beta£¨CD218b and IL1R7.
Accession # O95256
Formulation Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQW YQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACCVKMILEVKP QTNASCEYSASHKQDLLLGSTGSISCPSLSCQSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDY HQGTYVCDYTQSDTVSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGF ERVFNPVIKWYIKDSDLEWEVSVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIG NTTQSVQLKEKRVDHHHHHH
Background IL-18RAP is a single-pass type I membrane protein and contains two Ig-like C2-type domains and one TIR domain, IL18RAP can be induced by IFN-alpha and IL12 in nature killer cells and T-cells. The coexpression of IL18R1 and IL18RAP is required for the activation of NF-kappa B and JNK in response to IL-18.Defects in IL18RAP are associated with Coeliac disease.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese