elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Leucine-Rich α-2-Glycoprotein/LRG1

Recombinant Human Leucine-Rich α-2-Glycoprotein/LRG1 Recombinant Human Leucine-Rich α-2-Glycoprotein/LRG1

Instruction Manual!

Product name: Recombinant Human Leucine-Rich α-2-Glycoprotein/LRG1
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM NaCl,10%Glycerol,pH8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human LRG1 is produced by our Mammalian expression system and the target gene encoding Val36-Gln347 is expressed with a Fc, 6His tag at the C-terminus.
Names Leucine-rich alpha-2-glycoprotein, LRG and LRG1
Accession # P02750
Formulation Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM NaCl,10%Glycerol,pH8.0.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLS SNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKA LGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKD LLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFD ISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQVDDIEGRMDEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Background LRG1 is a secreted protein and contains eight LRR repeats and one LRRCT domain, It can be expressed during granulocyte differentiation. LRG1 has been shown to be involved in protein-protein interaction, signal transduction, cell adhesion and development. Levels of the LRG protein are markedly elevated in acute appendicitis and therefore could be used as a diagnostic aid.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese