Recombinant Human Transcobalamin II Receptor/TCblR/8D6A/CD320

Instruction Manual!

Product name:	Recombinant Human Transcobalamin II Receptor/TCblR/8D6A/CD320
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 10mM Tris-Citrate,150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Transcobalamin II Receptor is produced by our Mammalian expression system and the target gene encoding Ser36-Val231 is expressed with a 6His tag at the C-terminus.
Names	CD320 antigen,8D6 antigen,FDC-signaling molecule 8D6,FDC-SM-8D6,Transcobalamin receptor,TCblR,CD320
Accession #	Q9NPF0
Formulation	Lyophilized from a 0.2 μm filtered solution of 10mM Tris-Citrate,150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQC PPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDEL GCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYG VVDHHHHHH
Background	CD320 antigen is also known as 8D6 antigen，FDC-signaling molecule 8D6，Transcobalamin receptor and 8D6A. It is a single-pass type I membrane protein and containing two LDL-receptor class A domains. CD320 has been recently discovered and reported as a follicular dendritic cell (FDC) protein. CD320 can augments the proliferation of plasma cells precursors generated by IL-10. CD320 also founctions a receptor for the cellular uptake of transcobalamin bound cobalamin. Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC) which is a metabolic disorder.