Recombinant Human α-Lactalbumin/LALBA

Instruction Manual!

Product name:	Recombinant Human α-Lactalbumin/LALBA
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,PH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human alpha-lactalbumin is produced by our Mammalian expression system and the target gene encoding Lys20-Leu142 is expressed with a 6His tag at the C-terminus.
Names	Lactose synthase B protein, Lysozyme-like protein 7, LALBA, LYZL7
Accession #	P00709
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,PH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQ VPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLVDHHHHH H
Background	Alpha-lactalbumin(LALBA) is a secreted protein that is a member of the glycosyl hydrolase 22 family.It is expressed in mammary gland in milk. It is the regulatory subunit of lactose synthase.It changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme.