Recombinant Human N-Acetylgalactosaminyltransferase 7/GALNT7
Product name: | Recombinant Human N-Acetylgalactosaminyltransferase 7/GALNT7 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 50mM TrisHCl,10mM reduced Glutathione,PH8.0. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Human N-acetylgalactosaminyltransferase 7 is produced by our Mammalian expression system and the target gene encoding Pro30-Val657 is expressed with a 6His tag at the C-terminus. |
Names | PolypeptideGalNAc-transferase7,Protein-UDP acetylgalactosaminyltransferase7,UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7, GALNT7. |
Accession # | Q86SF2 |
Formulation | Supplied as a 0.2 μm filtered solution of 50mM TrisHCl,10mM reduced Glutathione,PH8.0. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
PRPDDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNE QEHHAGGDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLG PEFKQAIQASIKEFGFNMVASDMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWSTLM RTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQARSIGAQ KAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRTICTVPLIDVINGNTYEIIPQGGGDEDGYARG AWDWSMLWKRVPLTPQEKRLRKTKTEPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEI SYKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTLKNYVRVVEVWWDEYKDYFYASR PESQALPYGDISELKKFREDHNCKSFKWFMEEIAYDITSHYPLPPKNVDWGEIRGFETAYCIDSM GKTNGGFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGADGSKVMITHCNLNEFKEWQYFKNL HRFTHIPSGKCLDRSEVLHQVFISNCDSSKTTQKWEMNNIHSVVDHHHHHH
|
Background | N-acetylgalactosaminyltransferase 7(GALNT7) is expressed in uterus, retina, kidney, small intestine, omentum, stomach and CNS.It belongs to the glycosyltransferase 2 family and galNAc-T subfamily. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation. |