elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human N-Acetylgalactosaminyltransferase 7/GALNT7

Recombinant Human N-Acetylgalactosaminyltransferase 7/GALNT7 Recombinant Human N-Acetylgalactosaminyltransferase 7/GALNT7

Instruction Manual!

Product name: Recombinant Human N-Acetylgalactosaminyltransferase 7/GALNT7
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 50mM TrisHCl,10mM reduced Glutathione,PH8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human N-acetylgalactosaminyltransferase 7 is produced by our Mammalian expression system and the target gene encoding Pro30-Val657 is expressed with a 6His tag at the C-terminus.
Names PolypeptideGalNAc-transferase7,Protein-UDP acetylgalactosaminyltransferase7,UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7, GALNT7.
Accession # Q86SF2
Formulation Supplied as a 0.2 μm filtered solution of 50mM TrisHCl,10mM reduced Glutathione,PH8.0.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
PRPDDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNE QEHHAGGDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLG PEFKQAIQASIKEFGFNMVASDMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWSTLM RTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQARSIGAQ KAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRTICTVPLIDVINGNTYEIIPQGGGDEDGYARG AWDWSMLWKRVPLTPQEKRLRKTKTEPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEI SYKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTLKNYVRVVEVWWDEYKDYFYASR PESQALPYGDISELKKFREDHNCKSFKWFMEEIAYDITSHYPLPPKNVDWGEIRGFETAYCIDSM GKTNGGFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGADGSKVMITHCNLNEFKEWQYFKNL HRFTHIPSGKCLDRSEVLHQVFISNCDSSKTTQKWEMNNIHSVVDHHHHHH
Background N-acetylgalactosaminyltransferase 7(GALNT7) is expressed in uterus, retina, kidney, small intestine, omentum, stomach and CNS.It belongs to the glycosyltransferase 2 family and galNAc-T subfamily. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese