Recombinant Human ER Resident Protein 44/ERp44/TXNDC4

Instruction Manual!

Product name:	Recombinant Human ER Resident Protein 44/ERp44/TXNDC4
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris HCl，10%glycerol,PH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human ER resident protein 44 is produced by our Mammalian expression system and the target gene encoding Glu30-Asp402 is expressed with a 6His tag at the C-terminus.
Names	Thioredoxin domain-containing protein 4, ER protein 44, KIAA0573, TXNDC4
Accession #	Q9BS26
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris HCl，10%glycerol,PH7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQ HSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRS KRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYL GAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLIS EKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSG KLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDVDHHHHHH
Background	Endoplasmic reticulum resident protein 44 (TXNDC4) is is a 406 amino acid protein that contains one thioredoxin domain. TXNDC4 mediates thiol-dependent retention in the early secretory pathway and forms mixed disulfides with substrate proteins through its conserved CRFS motif.It can inhibit the calcium channel activity of ITPR1.It may have a role in the control of oxidative protein folding in the endoplasmic reticulum.