elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human α-1-Acid Glycoprotein 2/AGP2/ORM2

Recombinant Human α-1-Acid Glycoprotein 2/AGP2/ORM2 Recombinant Human α-1-Acid Glycoprotein 2/AGP2/ORM2

Instruction Manual!

Product name: Recombinant Human α-1-Acid Glycoprotein 2/AGP2/ORM2
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Alpha-1-acid glycoprotein 2 is produced by our Mammalian expression system and the target gene encoding Gln19-Ser201 is expressed with a 6His tag at the C-terminus.
Names Orosomucoid-2, OMD 2, ORM2, AGP2
Accession # P19652
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREY QTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADK PETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGESVDHHHHHH
Background Alpha-1-acid glycoprotein 2 is a secreted protein that belongs to the calycin superfamily, lipocalin family.It is expressed by the liver and secreted in plasma. It appears to function in modulating the activity of the immune system during the acute-phase reaction. It functions as transport protein in the blood stream. It binds various hydrophobic ligands in the interior of its beta-barrel domain. It also binds synthetic drugs and influences their distribution and availability.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese