Recombinant Human Ankyrin Repeat and SOCS Box Protein 13/ASB13

Instruction Manual!

Product name:	Recombinant Human Ankyrin Repeat and SOCS Box Protein 13/ASB13
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of PBS, pH 7.4, 4M Urea.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human ASB13 is produced by our E.coli expression system and the target gene encoding Met1-Asn278 is expressed with a 6His tag at the N-terminus.
Names	Ankyrin repeat and SOCS box protein 13, ASB13,
Accession #	Q8WXK3
Formulation	Supplied as a 0.2 μm filtered solution of PBS, pH 7.4, 4M Urea.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSIT PLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTAS PLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHET ALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVN LRKATGVRGLEKIAKLNIPPRLIDYLSYN
Background	Ankyrin repeat and SOCS box protein 13(ASB13) is a member of the ankyrin repeat and SOCS box-containing (ASB) family. ASB13 contain six ankyrin repeats sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. ASB13 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.