Recombinant Human Early Growth Response Protein 1/EGR1/ZNF225

Instruction Manual!

Product name:	Recombinant Human Early Growth Response Protein 1/EGR1/ZNF225
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Early growth response protein 1 is produced by our E.coli expression system and the target gene encoding Gln282-Ser433 is expressed with a 6His tag at the N-terminus.
Names	EGR-1, Early growth response protein 1, Zif268, zinc finger protein 225, NGFI-A , nerve growth factor-induced protein A,
Accession #	P18146
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYP NRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTH TGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS
Background	EGR-1 belongs to the EGR family of C2H2-type zinc finger proteins. It is a nuclear protein and functions as a transcriptional regulator. EGR-1 recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site).The products of target genes it activates are required for differentiation and mitogenesis. Studies suggest this is a tumor suppressor gene. EGR-1 has a distinct pattern of expression in the brain, and its induction has been shown to be associated with neuronal activity. Several studies suggest it has a role in neuronal plasticity. EGR-1 has also been found to regulate the expression of synaptobrevin II (a protein important for synaptic exocytosis).