Recombinant Human Nogo-A/Reticulon-4/RTN4

Instruction Manual!

Product name:	Recombinant Human Nogo-A/Reticulon-4/RTN4
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Reticulon-4 is produced by our E.coli expression system and the target gene encoding Met1-Val185 is expressed with a GST tag at the N-terminus.
Names	Reticulon-4, Neuroendocrine-specific protein, Neuroendocrine-specific protein C homolog, Foocen, Neurite outgrowth inhibitor, RTN-x, NOGO and Reticulon-5.
Accession #	Q9NQC3-3
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDE EEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPP VAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAP APAAPPSTPAAPKRRGSSGSV
Background	RTN4 belongs to multiple-pass membrane peotein, which anchored to the membrane of the endoplasmic reticulum through 2 putative transmembrane domains. It acts as a developmental neurite growth regulatory factor with a roles as a negative regulator of axon-axon adhesion and growth. RTN4 regulates neurite fasciculation, branching and extension in the developing nervous system. It involved in down-regulation of growth, stabilization of wring and restriction of plasticity in the adult CNS. It regulates the radial migration of cortical neurons via an RTN4R-Lingo1 containing receptor complex.