Recombinant E. coli Lactose Operon Repressor/LacI

Instruction Manual!

Product name:	Recombinant E. coli Lactose Operon Repressor/LacI
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 300mM NaCl, 5mM DTT pH 8.0 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant E.coli Lactose operon repressor is produced by our E.coli expression system and the target gene encoding Met1-Gln360 is expressed with a 6His tag at the C-terminus.
Names	Lactose operon repressor, LacI
Accession #	P03023
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 300mM NaCl, 5mM DTT pH 8.0 .
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIG VATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDD QDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSAR LRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITES GLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVK RKTTLAPNTQTASPRALADSLMQLARQVSRLESGQHHHHHH
Background	Lactose operon repressor (LacI) contains one HTH lacI-type DNA-binding domain, functions as a homotetramer. Lactose operon repressor as a repressor of the lactose operon, which also as an inducer, binds allolactose. If remove residues 1-59, resulting the loss of DNA-binding activity but retains tetrameric structure and inducer-binding activity. If delete residues 340-360, resulting the loss of tetramer formation, but retains dimer formation, inducer-binding activity, and DNA-binding activity.