Recombinant Human Chloride Intracellular Channel Protein 3/CLIC3

Instruction Manual!

Product name:	Recombinant Human Chloride Intracellular Channel Protein 3/CLIC3
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 10mM Tris, 0.1%Triton100, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human CLIC3 is produced by our E.coli expression system and the target gene encoding Met1-Arg236 is expressed with a 6His tag at the C-terminus.
Names	Chloride intracellular channel protein 3, CLIC3,
Accession #	O95833
Formulation	Supplied as a 0.2 μm filtered solution of 10mM Tris, 0.1%Triton100, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPIL LYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQ LLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPI PAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPRLEHHHHHH
Background	Chloride intracellular channel protein 3 (CLIC3) is encoded by the CLIC3 gene. CLIC3 is a single-pass membrane protein which belongs to the chloride channel CLIC family. It contains one GST C-terminal domain and one GST N-terminal domain. Chloride intracellular channel protein 3 high expressed in the placental, lung and heart, low expressed in skeletal muscle, kidney and pancreas. Chloride intracellular channel protein 3 can insert into membranes and forms chloride ion channels, may participate in cellular growth control.