Recombinant Human E3 Ubiquitin-Protein Ligase ZNRF1

Instruction Manual!

Product name:	Recombinant Human E3 Ubiquitin-Protein Ligase ZNRF1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.15M NaCl,1mMEDTA,10%glycerol, pH 8.0 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Zinc ring finger protein 1 is produced by our E.coli expression system and the target gene encoding Pro74-Thr178 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus.
Names	E3 ubiquitin-protein ligase ZNRF1, nerve injury-induced gene 283 protein, zinc/ring finger protein 1, NIN283, ZNRF1
Accession #	Q8ND25
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.15M NaCl,1mMEDTA,10%glycerol, pH 8.0 .
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLY LGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTLEHH HHHH
Background	E3 ubiquitin-protein ligase ZNRF1 contains one ring-type zinc finger, high expressed in the nervous system and developing brain, low expressed in testis and thymus. ZNRF1 mediates the ubiquitination of AKT1 and GLUL, so it plays a role in neuron cells differentiation. It also has a role in the establishment and maintenance of neuronal transmission and plasticity. ZNRF1 regulates Schwann cells differentiation by mediating ubiquitination of GLUL.