Recombinant Human E3 Ubiquitin-Protein Ligase ZNRF1
| Product name: | Recombinant Human E3 Ubiquitin-Protein Ligase ZNRF1 |
| Source: | E. coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.15M NaCl,1mMEDTA,10%glycerol, pH 8.0 . |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E. coli |
| Description | Recombinant Human Zinc ring finger protein 1 is produced by our E.coli expression system and the target gene encoding Pro74-Thr178 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. |
| Names | E3 ubiquitin-protein ligase ZNRF1, nerve injury-induced gene 283 protein, zinc/ring finger protein 1, NIN283, ZNRF1 |
| Accession # | Q8ND25 |
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.15M NaCl,1mMEDTA,10%glycerol, pH 8.0 . |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLY LGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTLEHH HHHH
|
| Background | E3 ubiquitin-protein ligase ZNRF1 contains one ring-type zinc finger, high expressed in the nervous system and developing brain, low expressed in testis and thymus. ZNRF1 mediates the ubiquitination of AKT1 and GLUL, so it plays a role in neuron cells differentiation. It also has a role in the establishment and maintenance of neuronal transmission and plasticity. ZNRF1 regulates Schwann cells differentiation by mediating ubiquitination of GLUL. |












