Recombinant Human Interleukin-25/IL25/MYDGF

Instruction Manual!

Product name:	Recombinant Human Interleukin-25/IL25/MYDGF
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human SF20 is produced by our E.coli expression system and the target gene encoding Ser33-Leu173 is expressed with a 6His tag at the N-terminus.
Names	UPF0556 protein C19orf10, interleukin-25, stromal cell-derived growth factor SF20, IL-25, C19orf10.
Accession #	Q969H8
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQ WQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEF EVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
Background	C19orf10 is a secreted protein which belongs to the UPF0556 family. It is expressed in synovial tissue and detected in synovial fluid of patients with arthropaties. C19orf10 plays a role in proliferation of lymphoid cells and is considered an interleukin.