Recombinant Human Zinc Finger HIT Domain-Containing Protein 1/ZNHIT1/ZNFN4A1

Instruction Manual!

Product name:	Recombinant Human Zinc Finger HIT Domain-Containing Protein 1/ZNHIT1/ZNFN4A1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB，150mM NaCl，50% Glycerol,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Zinc Finger HIT Domain-Containing Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Val154 is expressed with a 6His tag at the N-terminus.
Names	inc finger HIT domain-containing protein 1, cyclin-G1-binding protein 1, zinc finger protein subfamily 4A member 1, p18 hamlet, CGBP1, ZNFN4A1, ZNHIT1
Accession #	O43257
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB，150mM NaCl，50% Glycerol,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPH AGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPS RPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
Background	ZNHIT1 belongs to the ZNHIT1 family and contains one HIT-type zinc finger. It can be phosphorylated on Thr by MAPK11 or MAPK14. ZNHIT1 is a component of the chromatin-remodeling SRCAP complex, which is composed of at least SRCAP, DMAP, RUVBL1, RUVBL2, ACTL6A, YEATS4, ACTR6 and ZNHIT1. ZNHIT1 may play a role in p53-mediated apoptosis induction.