Recombinant Human Casein kinase I γ-2/CSNK1G2

Instruction Manual!

Product name:	Recombinant Human Casein kinase I γ-2/CSNK1G2
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,500mM NaCl,10%Glycerol,1mM DTT, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human CSNK1G2 is produced by our E.coli expression system and the target gene encoding Met18-Lys415 is expressed with a 6His tag at the N-terminus.
Names	Casein kinase I isoform gamma-2, CK1G2, CSNK1G2
Accession #	P78368
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,500mM NaCl,10%Glycerol,1mM DTT, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRL GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLELLGPSLE DLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLA KEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKA DTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGFV FDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITA PAEVEVADETKCCCFFKRRKRKSLQRHK
Background	CSNK1G2 is a cytoplasmic protein which contains one protein kinase domain. It is amember of the CK1 Ser/Thr protein kinase family of the large casein kinase I (CKI) subfamily. CSNK1G2 participates in Wnt signaling, involves in brain development and vesicular trafficking and neurotransmitter releasing from small synaptic vesicles. It regulates fast synaptic transmission mediated by glutamate. SMAD3 phosphorylation promotes its ligand-dependent ubiquitination and subsequent proteasome degradation, thus inhibiting SMAD3-mediated TGF-beta responses.