Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP4/FKBP4

Instruction Manual!

Product name:	Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP4/FKBP4
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris，10%glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human FKBP52 is produced by our E.coli expression system and the target gene encoding Met1-Ala459 is expressed with a 6His tag at the C-terminus.
Names	Peptidyl-prolyl cis-trans isomerase FKBP4, 51kDa FK506-binding protein, 51kDa FK506-binding protein, 59kDa immunophilin, FK506-binding protein 4, FKBP59, HSP-binding immunophilin, immunophilin FKBP52, Rotamase, FKBP4
Accession #	Q02790
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris，10%glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGT KFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVF EVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEG ENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKESWE MNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNL AMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAK TQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQV ETEALEHHHHHH
Background	FKBP4 act as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly. FKBP4 may play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments, it also may have a protective role against oxidative stress in mitochondria. The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening.