Recombinant Human Profilin-2/PFN2

Instruction Manual!

Product name:	Recombinant Human Profilin-2/PFN2
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris，150mM NaCl，pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Profilin-2 is produced by our E.coli expression system and the target gene encoding Met1-Phe140 is expressed.
Names	Profilin-II, PFN2, Profilin-2, PFL
Accession #	P35080
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris，150mM NaCl，pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLA LGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYS MAKYLRDSGF
Background	Profilin-II (PFN2) is ubiquitous protein which belongs to the profilin family. PFN2 binds to actin, thenaffects the structure of the cytoskeleton. At high concentrations, profiling prevents the polymerization of actin, while increases that at low concentrations. PFN2 is a ubiquitous actin monomer-binding protein. It regulates actin polymerization in response to extra cellular signals. PFN2 binds to PIP2; it inhibits the formation of IP3 and DG.