Recombinant Human Heat Shock Protein β-7/HSPB7
Product name: | Recombinant Human Heat Shock Protein β-7/HSPB7 |
Source: | E. coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM Tris,0.2M NaCl,2mM DTT,50%glycerol, pH 8.0. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E. coli |
Description | Recombinant Human Heat shock protein beta-7 is produced by our E.coli expression system and the target gene encoding Met1-Ile170 is expressed with a 6His tag at the C-terminus. |
Names | Pregnancy specific beta-1-glycoprotein 2, PSBG2, Pregnancy-specific beta-1 glycoprotein E, pregnancy-specific beta-1-glycoprotein 2, pregnancy-specific beta-1-glycoprotein 7, PSG2 |
Accession # | Q9UBY9 |
Formulation | Supplied as a 0.2 μm filtered solution of 20mM Tris,0.2M NaCl,2mM DTT,50%glycerol, pH 8.0. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAF PARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPE DVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKILEHHHHHH
|
Background | PSG2 is a secreted protein that in humans is encoded by the PSG2 gene. It is a member of the human pregnancy-specific glycoproteins (PSGs) family. These proteins are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. PSG2 consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. It has an arg-gly-asp (RGD) motif, which has been shown to function as an adhesion recognition signal for several integrins, in the N-terminal domain. |