elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Heat Shock Protein β-7/HSPB7

Recombinant Human Heat Shock Protein β-7/HSPB7 Recombinant Human Heat Shock Protein β-7/HSPB7

Instruction Manual!

Product name: Recombinant Human Heat Shock Protein β-7/HSPB7
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM Tris,0.2M NaCl,2mM DTT,50%glycerol, pH 8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human Heat shock protein beta-7 is produced by our E.coli expression system and the target gene encoding Met1-Ile170 is expressed with a 6His tag at the C-terminus.
Names Pregnancy specific beta-1-glycoprotein 2, PSBG2, Pregnancy-specific beta-1 glycoprotein E, pregnancy-specific beta-1-glycoprotein 2, pregnancy-specific beta-1-glycoprotein 7, PSG2
Accession # Q9UBY9
Formulation Supplied as a 0.2 μm filtered solution of 20mM Tris,0.2M NaCl,2mM DTT,50%glycerol, pH 8.0.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAF PARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPE DVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKILEHHHHHH
Background PSG2 is a secreted protein that in humans is encoded by the PSG2 gene. It is a member of the human pregnancy-specific glycoproteins (PSGs) family. These proteins are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. PSG2 consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. It has an arg-gly-asp (RGD) motif, which has been shown to function as an adhesion recognition signal for several integrins, in the N-terminal domain.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese