Recombinant Human Nucleolar Protein Family A Member 2/NHP2/NOLA2

Instruction Manual!

Product name:	Recombinant Human Nucleolar Protein Family A Member 2/NHP2/NOLA2
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,1mM DTT, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human NHP2 is produced by our E.coli expression system and the target gene encoding Met1-Leu153 is expressed with a 6His tag at the N-terminus.
Names	H/ACA ribonucleoprotein complex subunit 2, Nucleolar protein family A member 2, snoRNP protein NHP2, NHP2, NOLA2, NHP2P.
Accession #	Q9NX24
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,1mM DTT, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTR KLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPS KTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL
Background	NHP2 belongs to the H/ACA snoRNPs gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been organized into 2 families: C/D and H/ACA. NHP2 forms a small ribonucleoprotein particle with GAR1 (NOLA1). NHP2 is involved in a variety of aspects of rRNA processing and modification. NHP2 localizes to the dense fibrillar component of the nucleolus and in nuclear Cajal bodies. NHP2 may also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.