Recombinant Human C1QBP/HABP1

Instruction Manual!

Product name:	Recombinant Human C1QBP/HABP1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 20% Glycerol, 1mM DTT, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Hyaluronic Acid-binding Protein is produced by our E.coli expression system and the target gene encoding Leu74-Gln282 is expressed with a 6His tag at the C-terminus.
Names	Complement Component 1 Q Subcomponent-Binding Protein Mitochondrial, ASF/SF2-Associated Protein p32, Glycoprotein gC1qBP, C1qBP, Hyaluronan-Binding Protein 1, Mitochondrial Matrix Protein p32, gC1q-R Protein, p33, C1QBP, GC1QBP, HABP1, SF2P32
Accession #	Q07021
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 20% Glycerol, 1mM DTT, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINN SIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESD IFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQE YITFLEDLKSFVKSQLEHHHHHH
Background	Complement Component 1Q Subcomponent-Binding Protein (C1QBP) is a nucleus protein that belongs to the MAM33 family. C1QBP is known to bind to the globular heads of C1q molecules and inhibit C1 activation. Mitochondrial C1QBP is a critical mediator of p14ARF-induced apoptosis. C1QBP functions as a chemotactic factor for immature dendritic cells, and migration is mediated through ligation of both C1QBP and cC1qR/CR. C1QBP overexpression successfully blocks mRNA accumulation from the adenovirus major late transcription unit (MLTU) and stimulates RNA polymerase II carboxy-terminal domain phosphorylation in virus-infected cells.