Recombinant Human Zinc Finger Protein 762/ZFN762/ZIK1

Instruction Manual!

Product name:	Recombinant Human Zinc Finger Protein 762/ZFN762/ZIK1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Zinc Finger Protein 762 is produced by our E.coli expression system and the target gene encoding Met1-Cys384 is expressed with a T7 tag at the N-terminus.
Names	Zinc Finger Protein Interacting with Ribonucleoprotein K, Zinc Finger Protein 762, ZIK1, ZNF762
Accession #	Q3SY52
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH 7.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MASMTGGQQMGRGSMAAAALRAPTQVTVSPETHMDLTKGCVTFEDIAIYFSQDEWGLLDEAQRLL YLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQSCEMCVPVLKDILHLA DLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAMLR LLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYECSKCGK AFRGKYSLVQHQRVHTGERPWECNECGKFFSQTSHLNDHRRIHTGERPYECSECGKLFRQNSSLV DHQKIHTGARPYECSQCGKSFSQKATLVKHQRVHTGERPYKCGECGNSFSQSAILNQHRRIHTGA KPYECGQC
Background	Zinc Finger Protein Interacting with Ribonucleoprotein K (ZIK1) is a 487 amino acid nuclear protein that belongs to the Krueppel C2H2-Type Zinc-Finger Protein family. ZIK1 has nine C2H2-type zinc fingers and a KRAB domain. This protein is expressed at high levels in the gastric glands and at low levels in the colon and small intestine. It has been shown that ZIK1 is a transcriptional repressor that interacts with the Heterogeneous Nuclear Ribonucleoprotein Particle K Protein (HNRPK).