Recombinant Human Synaptobrevin Homolog YKT6/YKT6

Instruction Manual!

Product name:	Recombinant Human Synaptobrevin Homolog YKT6/YKT6
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM Tris, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Synaptobrevin Homolog YKT6 is produced by our E.coli expression system and the target gene encoding Met1-Met198 is expressed with a 6His tag at the N-terminus.
Names	Synaptobrevin homolog YKT6, YKT6
Accession #	O15498
Formulation	Supplied as a 0.2 μm filtered solution of 50mM Tris, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKG TRASVKEQDYLCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIH YPALDGHLSRYQNPREADPMTKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAF YKTARKQNSCCAIMLDLQSR
Background	Synaptobrevin Homolog YKT6 (YKT6) is an enzyme that belongs to the Synaptobrevin family. YKT6 contains a longin domain and a v-SNARE coiled-coil homology domain. YKT6 is highly conserved from yeast to human and it can functionally complement the loss of the yeast homolog in the yeast secretory pathway. It is a membrane associated, isoprenylated protein that functions at the endoplasmic reticulum-Golgi transport step. YKT6 is considered as one of the SNARE recognition molecules implicated in vesicular transport between secretory compartments.