Recombinant Human BNIP3/NIP3

Instruction Manual!

Product name:	Recombinant Human BNIP3/NIP3
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human BNIP3 is produced by our E.coli expression system and the target gene encoding Met1-Leu166 is expressed with a 6His tag at the N-terminus.
Names	BCL2/Adenovirus E1B 19 kDa Protein-Interacting Protein 3, BNIP3, NIP3
Accession #	Q12983
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHES GRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWD WSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV
Background	BCL2/Adenovirus E1B 19 kDa Protein-Iinteracting Protein 3 (BNIP3) is a single-pass membrane protein. BNIP3 is a member of the NIP3 family. BNIP3 contains a single Bcl-2 homology 3 domain and interacts with the E1B 19 kDa protein. BNIP3 have been associated with pro-apoptotic function. BNIP3 is an apoptosis-inducing protein that can overcome BCL2 suppression. It plays a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. BNIP3 involved in mitochondrial quality control via its interaction with SPATA18/MIEAP, response to mitochondrial damage, participates to mitochondrial protein catabolic process.