elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Sulfotransferase 1B1/SULT1B1

Recombinant Human Sulfotransferase 1B1/SULT1B1 Recombinant Human Sulfotransferase 1B1/SULT1B1

Instruction Manual!

Product name: Recombinant Human Sulfotransferase 1B1/SULT1B1
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, pH 8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human Sulfotransferase 1B1 is produced by our E.coli expression system and the target gene encoding Met1-Ile296 is expressed with a 6His tag at the N-terminus.
Names Sulfotransferase Family Cytosolic 1B Member 1, ST1B1, Sulfotransferase 1B1, Sulfotransferase 1B2, ST1B2, Thyroid Hormone Sulfotransferase, SULT1B1, ST1B2, SULT1B2
Accession # O43704
Formulation Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, pH 8.0.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MNHKVHHHHHHMLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWV SEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSF WENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRK EEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVM DHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Background Sulfotransferase Family Cytosolic 1B Member 1 (SULT1B1) is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. Human SULT1B1 is a 296 amino acid protein that is highly expressed in the liver, peripheral blood leukocytes, colon, small intestine, and spleen. SULT1B1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it can catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese