Recombinant Human Sulfotransferase 2A1/SULT2A1

Instruction Manual!

Product name:	Recombinant Human Sulfotransferase 2A1/SULT2A1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Sulfotransferase 2A1 is produced by our E.coli expression system and the target gene encoding Ser2-Glu285 is expressed with a 6His tag at the N-terminus.
Names	Bile Salt Sulfotransferase, Dehydroepiandrosterone Sulfotransferase, DHEA-ST, Hydroxysteroid Sulfotransferase, HST, ST2, ST2A3, Sulfotransferase 2A1, ST2A1, SULT2A1, HST, STD
Accession #	Q06520
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEIL CLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYL MRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSY EELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKG VSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Background	Bile Salt Sulfotransferase (SULT2A1( is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. SULT2A1 is primarily expressed in the liver and adrenal tissues, and to a lesser extent in the kidney. SULT2A1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. SULT2A1 may have a role in the inherited adrenal androgen excess.