Recombinant Human Sulfotransferase 1A1/SULT1A1

Instruction Manual!

Product name:	Recombinant Human Sulfotransferase 1A1/SULT1A1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,1mM EDTA,pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Sulfotransferase 1A1 is produced by our E.coli expression system and the target gene encoding Met1-Leu295 is expressed with a 6His tag at the N-terminus.
Names	Sulfotransferase 1A1, ST1A1, Aryl sulfotransferase 1, HAST1/HAST2, Phenol Sulfotransferase 1, Phenol-Sulfating Phenol Sulfotransferase 1, P-PST 1, ST1A3, Thermostable Phenol Sulfotransferase, Ts-PST, SULT1A1, STP, STP1, OK/SW-cl.88
Accession #	P50225
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,1mM EDTA,pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWV SQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLL DQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSR THPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMD HSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Background	Sulfotransferase 1A1 (SULT1A1) is a cytosolic sulfotransferases that is expressed in the liver, lung, adrenal, brain, platelets, and skin. SULT1A1 is a phenol sulfotransferases with thermostable enzyme activity. SULT1A1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. It is responsible for the sulfonation and activation of minoxidil. SULT1A1 mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.