Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10

Instruction Manual!

Product name:	Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 C is produced by our E.coli expression system and the target gene encoding Met1-Pro179 is expressed with a 6His tag at the N-terminus.
Names	Ubiquitin-Conjugating Enzyme E2 C, UbcH10, Ubiquitin Carrier Protein C, Ubiquitin-Protein Ligase C, UBE2C, UBCH10
Accession #	O00762
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MRGSHHHHHHGSMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAF PESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDIL KEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Background	Ubiquitin-Conjugating Enzyme E2 C (UBE2C) is a 179 amino acid enzyme that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2C is highly expressed in tumor tissues and at low levels in most adult normal tissues. UBE2C is required for the destruction of mitotic cyclins and for cell cycle progression. UBE2C accepts Ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. It acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), which has E3 ubiquitin ligase activity, and targets for destruction substrates from the preceding mitosis (Cyclin A, Cyclin B, Securin, Geminin).