elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Calpain-2 Catalytic Subunit/CAPN2

Recombinant Human Calpain-2 Catalytic Subunit/CAPN2 Recombinant Human Calpain-2 Catalytic Subunit/CAPN2

Instruction Manual!

Product name: Recombinant Human Calpain-2 Catalytic Subunit/CAPN2
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,2mM DTT,50% Glycerol,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human CAPN2 is produced by our E.coli expression system and the target gene encoding Met1-Leu700 is expressed with a 6His tag at the C-terminus.
Names Calpain-2 Catalytic Subunit, Calcium-Activated Neutral Proteinase 2, CANP 2, Calpain M-Type, Calpain Large Polypeptide L2, Calpain-2 Large Subunit, Millimolar-Calpain, M-Calpain, CAPN2, CANPL2
Accession # P17655
Formulation Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,2mM DTT,50% Glycerol,pH7.4.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGP YSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQS FQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEAL SGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVK GHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRRHEDGEFW MSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIK LEEEDEDEEDGESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLT NRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANL EEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLD SDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARF ADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVLVEHHHHHH
Background Calpain-2 Catalytic Subunit (CANP2) is an intracellular cysteine protease. It contains 1 calpain catalytic domain and 3 EF-hand domains. CANP2 is a member of the peptidase C2 family of intracellular Ca2+-regulated cysteine proteases. These ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits (CANP2) associated with a common small, regulatory subunit (CAPNS1). CANP2 is activated by 200-1000 micromolar concentrations of calcium and inhibited by calpastatin. CANP2 is calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese