Recombinant Human Calpain-2 Catalytic Subunit/CAPN2
Product name: | Recombinant Human Calpain-2 Catalytic Subunit/CAPN2 |
Source: | E. coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,2mM DTT,50% Glycerol,pH7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E. coli |
Description | Recombinant Human CAPN2 is produced by our E.coli expression system and the target gene encoding Met1-Leu700 is expressed with a 6His tag at the C-terminus. |
Names | Calpain-2 Catalytic Subunit, Calcium-Activated Neutral Proteinase 2, CANP 2, Calpain M-Type, Calpain Large Polypeptide L2, Calpain-2 Large Subunit, Millimolar-Calpain, M-Calpain, CAPN2, CANPL2 |
Accession # | P17655 |
Formulation | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,2mM DTT,50% Glycerol,pH7.4. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGP YSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQS FQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEAL SGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVK GHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRRHEDGEFW MSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIK LEEEDEDEEDGESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLT NRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANL EEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLD SDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARF ADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVLVEHHHHHH
|
Background | Calpain-2 Catalytic Subunit (CANP2) is an intracellular cysteine protease. It contains 1 calpain catalytic domain and 3 EF-hand domains. CANP2 is a member of the peptidase C2 family of intracellular Ca2+-regulated cysteine proteases. These ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits (CANP2) associated with a common small, regulatory subunit (CAPNS1). CANP2 is activated by 200-1000 micromolar concentrations of calcium and inhibited by calpastatin. CANP2 is calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. |