Recombinant Human Sulfotransferase 1A3/SULT1A3

Instruction Manual!

Product name:	Recombinant Human Sulfotransferase 1A3/SULT1A3
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Sulfotransferase 1A3 is produced by our E.coli expression system and the target gene encoding Met1-Leu295 is expressed with a 6His tag at the N-terminus.
Names	Sulfotransferase 1A3/1A4, ST1A3/ST1A4, Aryl Sulfotransferase 1A3/1A4, Catecholamine-Sulfating Phenol Sulfotransferase, HAST3, M-PST, Monoamine-Sulfating Phenol Sulfotransferase, Placental Estrogen Sulfotransferase, Sulfotransferase Monoamine-Preferring, Thermolabile Phenol Sulfotransferase, TL-PST, SULT1A3, STM, SULT1A4
Accession #	P50224
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWV SQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLL DQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSR THPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMD HSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Background	Sulfotransferase 1A3/1A4 (SULT1A3) is 295 amino acids in length and localizes to the cytoplasm. It is a member of the Sulfotransferase 1 family. SULT1A3 can be found in the liver, colon, kidney, lung, brain, spleen, small intestine, placenta, and leukocytes. SULT1A3 exists as a homodimer and it catalyzes the sulfation of phenolic monoamines, such as dopamine, norepinephrine and serotonin, and phenolic and catecholic drugs.