Recombinant Human Zinc Finger C4H2 Domain-Containing Protein/ZC4H2/HCA127

Instruction Manual!

Product name:	Recombinant Human Zinc Finger C4H2 Domain-Containing Protein/ZC4H2/HCA127
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 250mM NaCl, 500mM Imidazole, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Zinc Finger C4H2 Domain-Containing Protein is produced by our E.coli expression system and the target gene encoding Met1-Glu224 is expressed with a 6His tag at the N-terminus.
Names	Zinc Finger C4H2 Domain-Containing Protein, Hepatocellular Carcinoma-Associated Antigen 127, ZC4H2, HCA127, KIAA1166
Accession #	Q9NQZ6
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 250mM NaCl, 500mM Imidazole, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHL KEYKQEMDLLLQEKMAHVEELRLIHADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDA LRMTLGLQRLPDLCEEEEKLSLDYFEKQKAEWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQ TATFRQQPPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRKQDE
Background	Zinc Finger C4H2 Domain-Containing Protein (ZC4H2) is a protein with 224 amino acids. ZC4H2 is a member of the zinc finger domain-containing protein family. ZC4H2 contains a C4H2-type zinc finger and is thought to be involved in zinc ion binding. This protein has been detected as an autoantigen in hepatocellular carcinoma patients. ZC4H2 is a potential candidate for X-linked mental retardation.