Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2/UBE2R2/UBC3B

Instruction Manual!

Product name:	Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2/UBE2R2/UBC3B
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mm HEPES,150mM NaCl, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2 is produced by our E.coli expression system and the target gene encoding Met1-Ser238 is expressed with a 6His tag at the N-terminus.
Names	Ubiquitin-Conjugating Enzyme E2 R2, Ubiquitin Carrier Protein R2, Ubiquitin-Conjugating Enzyme E2-CDC34B, Ubiquitin-Protein Ligase R2, UBE2R2, CDC34B, UBC3B
Accession #	Q712K3
Formulation	Supplied as a 0.2 μm filtered solution of 50mm HEPES,150mM NaCl, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAI FGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELP SERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAE AEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
Background	Ubiquitin-Conjugating Enzyme E2 R2 (UBE2R2) is a modification enzyme that belongs to the ubiquitin-conjugating enzyme family. UBE2R2 is involved in cell growth and transformation. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2R2 catalyzes monoubiquitination and 'Lys-48'-linked polyubiquitination. It may be involved in degradation of katenin.