Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2/UBE2V2/DDVIT1

Instruction Manual!

Product name:	Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2/UBE2V2/DDVIT1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mm HEPES,150mM NaCl, pH 7.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2 is produced by our E.coli expression system and the target gene encoding Met1-Asn145 is expressed with a 6His tag at the N-terminus.
Names	Ubiquitin-Conjugating Enzyme E2 Variant 2, DDVit 1, Enterocyte Differentiation-Associated Factor 1, EDAF-1, Enterocyte Differentiation-Promoting Factor 1, EDPF-1, MMS2 Homolog, Vitamin D3-Inducible Protein, UBE2V2, MMS2, UEV2
Accession #	Q15819
Formulation	Supplied as a 0.2 μm filtered solution of 50mm HEPES,150mM NaCl, pH 7.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTR WTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQ NSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
Background	Ubiquitin-Conjugating Enzyme E2 Variant 2 (UBE2V2) is an enzyme that belongs to the ubiquitin-conjugating enzyme family. UBE2V2 can be detected in the placenta, colon, liver, and skin. It forms a heterodimer with UBE2N. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains and which leads to protein degradation by the proteasome. UBE2V2 mediates transcriptional activation of target genes. It plays a role in the control of progress through the cell cycle and differentiation. It also plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.