Recombinant Human Ubiquitin/ISG15-Conjugating Enzyme E2 L6/UBE2L6//UbcH8

Instruction Manual!

Product name:	Recombinant Human Ubiquitin/ISG15-Conjugating Enzyme E2 L6/UBE2L6//UbcH8
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 L6 is produced by our E.coli expression system and the target gene encoding Met1-Ser153 is expressed with a 6His tag at the C-terminus.
Names	Ubiquitin/ISG15-Conjugating Enzyme E2 L6, Retinoic Acid-Induced Gene B Protein, RIG-B, UbcH8, Ubiquitin Carrier Protein L6, Ubiquitin-Protein Ligase L6, UBE2L6, UBCH8
Accession #	O14933
Formulation	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKP PMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLT QNPELFRKNAEEFTLRFGVDRPSLEHHHHHH
Background	Ubiquitin/ISG15-Conjugating Enzyme E2 L6 (UBE2L6) is an enzyme member of the E2 ubiquitin-conjugating enzyme family. UBE2L6 plays a same function as UBE2D, it catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. UBE2L6 promotes ubiquitination and subsequent proteasomal degradation of FLT3. It has functions in the E6/E6-AP-induced ubiquitination of p53/TP53.