Recombinant Human Tryptophan 5-Hydroxylase 2/TPH2

Instruction Manual!

Product name:	Recombinant Human Tryptophan 5-Hydroxylase 2/TPH2
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Tryptophan 5-Hydroxylase 2 is produced by our E.coli expression system and the target gene encoding Met1-Ile496 is expressed with a 6His tag at the N-terminus.
Names	Tryptophan 5-Hydroxylase 2, Neuronal Tryptophan Hydroxylase, Tryptophan 5-Monooxygenase 2, TPH2, NTPH
Accession #	Q14CC5
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMQPAMMMFSSKYWARRGFSLDSAVPEEHQLLGSSTASTFLKLNKPNSGKNDDKG NKGSSKREAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCE CGKTEFNELIQLLKFQTTIVTLNPPENIWTEEEELEDVPWFPRKISELDKCSHRVLMYGSELDAD HPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYLKNF PLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQYIRHGSDP LYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQEGQL RAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYFVSESFEEAKEKMRDFAKS ITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLGIVDLQSR
Background	Tryptophan 5-hydroxylase 2 (TPH2) is an isozyme member of the biopterin-dependent aromatic amino acid hydroxylase family. TPH2 is primarily expressed in the serotonergic neurons of the brain, with the highest expression found in the raphe nucleus of the midbrain. TPH2 catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Genetic variation in TPH2 may influence susceptibility to major depressive disorder (MDD). Defects in TPH2 are the cause of psychiatric diseases such as bipolar affective disorder and major depression.