Recombinant Human Serum Amyloid A4/SAA4
Product name: | Recombinant Human Serum Amyloid A4/SAA4 |
Source: | E. coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, 0.5mM EDTA, 20% Glycerol, pH 8.0. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E. coli |
Description | Recombinant Human Serum Amyloid A4 Protein is produced by our E.coli expression system and the target gene encoding Glu19-Thr130 is expressed with a 6His tag at the C-terminus. |
Names | Serum Amyloid A-4 Protein, Constitutively Expressed Serum Amyloid A Protein, C-SAA, SAA4, CSAA |
Accession # | P35542 |
Formulation | Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, 0.5mM EDTA, 20% Glycerol, pH 8.0. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVY LQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKYLEHHHHHH
|
Background | Serum Amyloid A-4 Protein (SAA4) is a member of the SAA family. SAA proteins are a family of apolipoproteins associated with high-density lipoprotein (HDL) in plasma. SAA4 is constitutively expressed only in humans and mice. Its physiological function is unknown. SAA4 functions as a major acute phase reactant. SAA4 mRNA and protein occurrence in macrophage derived foam cells of coronary and carotid arteries implied a specific role of human SAA4 during inflammation including atherosclerosis. |