Recombinant Human Parathyroid Hormone-Related Protein/PTHLH

Instruction Manual!

Product name:	Recombinant Human Parathyroid Hormone-Related Protein/PTHLH
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Parathyroid Hormone-Related Protein is produced by our E.coli expression system and the target gene encoding Ala37-Arg175 is expressed with a 6His tag at the C-terminus.
Names	Parathyroid Hormone-Related Protein, PTH-rP, PTHrP, Parathyroid Hormone-Like Protein, PLP, PTHrP [1-36], PTHrP [38-94], Osteostatin, PTHrP [107-139], PTHLH, PTHRP
Accession #	P12272-2
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDE GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDT STTSLELDSRLEHHHHHH
Background	Parathyroid Hormone-Related protein (PTHRP) is a member of the parathyroid hormone family. PTHRP is known as a potent inhibitor of chondrocyte maturation. PTHRP is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. PTHRP also regulates epithelial-mesenchymal interactions during the formation of the mammary glands. During endochondral bone development, PTHRP plays a major role in suppressing the onset of hypertrophic differentiation. Defects in PTHRP are the cause of Brachydactyly Type E2.