Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1

Instruction Manual!

Product name:	Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl，10% Glycerol,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human TRIM is produced by our E.coli expression system and the target gene encoding Asn29-Asn186 is expressed with a 6His tag at the C-terminus.
Names	T-Cell Receptor-Associated Transmembrane Adapter 1, T-Cell Receptor-Interacting Molecule, TRIM, pp29/30, TRAT1, TCRIM, HSPC062
Accession #	Q6PIZ9
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl，10% Glycerol,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNK MQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFS PESQAVEENIHDDPIRLFGLIRAKREPINLEHHHHHH
Background	T-Cell Receptor-Associated Transmembrane Adapter 1 (TRAT1) is a single-pass type III membrane protein. TRAT1 exists as a disulfide-linked homodimer and is strongly expressed in the thymus, and to a lesser extent in the spleen, lymph node, and peripheral blood lymphocytes. TRAT1 is phosphorylated on tyrosines by LCK or FYN upon TCR activation. Its function is to stabilizes the TCR (T-cell antigen receptor)/CD3 complex at the surface of T-cells.