Recombinant Human Mitochondrial Fission 1 Protein/FIS1

Instruction Manual!

Product name:	Recombinant Human Mitochondrial Fission 1 Protein/FIS1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Mitochondrial Fission 1 Protein is produced by our E.coli expression system and the target gene encoding Met1-Gly122 is expressed with a 6His tag at the C-terminus.
Names	Mitochondrial Fission 1 Protein, FIS1 Homolog, hFis1, Tetratricopeptide Repeat Protein 11, TPR Repeat Protein 11, FIS1, TTC11, CGI-135
Accession #	Q9Y3D6
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKG SKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGVEHHHHHH
Background	Mitochondrial Fission 1 Protein (FIS1) is a member of the FIS1 family. FIS1 is a single-pass membrane protein and contains one TPR repeat. FIS1 is part of the mitochondrial complex that promotes mitochondrial fission. FIS1 can induce cytochrome C discharge from the mitochondrion to the cytosol, eventually leading to apoptosis. In addition, FIS1 participates in peroxisomal growth and division. The C-terminus of FIS1 is required for mitochondrial or peroxisomal localization, while the N-terminus is necessary for mitochondrial or peroxisomal fission, localization and regulation of the interaction with DNM1L.