Recombinant Human Ubiquitin-Conjugating Enzyme E2 I/UBE2I

Instruction Manual!

Product name:	Recombinant Human Ubiquitin-Conjugating Enzyme E2 I/UBE2I
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 I is produced by our E.coli expression system and the target gene encoding Met1-Ser158 is expressed with a GST tag at the N-terminus.
Names	SUMO-Conjugating Enzyme UBC9, SUMO-Protein Ligase, Ubiquitin Carrier Protein 9, Ubiquitin Carrier Protein I, Ubiquitin-Conjugating Enzyme E2 I, Ubiquitin-Protein Ligase I, p18, UBE2I, UBC9, UBCE9
Accession #	P63279
Formulation	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPD GTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILE EDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
Background	SUMO-Conjugating Enzyme UBC9 (UBC9) belongs to the ubiquitin-conjugating enzyme family. UBC9 is homologous to ubiquitin-conjugating enzymes (E2s). However, instead of conjugating ubiquitin, UBC9 conjugates a ubiquitin homologue, Small Ubiquitin-Like Modifier 1 (SUMO-1). The conjugation of ubiquitin requires the activities of ubiquitin-activating (E1) and conjugating (E2) enzymes. It is suggested that UBC9 might play a role in DNA repair and perhaps even in aging.