Recombinant Human Allograft Inflammatory Factor 1/AIF1

Instruction Manual!

Product name:	Recombinant Human Allograft Inflammatory Factor 1/AIF1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Allograft Inflammatory Factor 1 is produced by our E.coli expression system and the target gene encoding Ser2-Pro147 is expressed with a 6His tag at the C-terminus.
Names	Allograft Inflammatory Factor 1, AIF-1, Ionized Calcium-Binding Adapter Molecule 1, Protein G1, AIF1, G1, IBA1
Accession #	P55008
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDID IMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREK EKPTGPPAKKAISELPLEHHHHHH
Background	Allograft Inflammatory Factor 1 (AIF1) contains two EF-hand domains and exists as a homodimer. AIF1 can be detected in T-lymphocytes and peripheral blood mononuclear cells. AIF1 functions as actin-binding protein that enhances membrane ruffling and RAC activation and can enhance the actin-bundling activity of LCP1. In addition, AIF1 plays a role in RAC signaling and in phagocytosis and may also in macrophage activation and function. AIF1 promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes and plays a role in vascular inflammation.