Recombinant Human SH2 Domain-Containing Protein 1A/SH2D1A/SAP/DSHP

Instruction Manual!

Product name:	Recombinant Human SH2 Domain-Containing Protein 1A/SH2D1A/SAP/DSHP
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human SH2D1A is produced by our E.coli expression system and the target gene encoding Met1-Pro128 is expressed with a 6His tag at the N-terminus.
Names	SH2 Domain-Containing Protein 1A, Duncan Disease SH2-Protein, Signaling Lymphocytic Activation Molecule-Associated Protein, SLAM-Associated Protein, T-Cell Signal Transduction Molecule SAP, SH2D1A, DSHP, SAP
Accession #	O60880
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCV LYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARS TQGTTGIREDPDVCLKAP
Background	SH2 Domain-Containing Protein 1A,(SH2D1A) contains one SH2 domain and a short tail and is localized in the cytoplasm. SH2D1A is expressed at a high level in the thymus and the lung, with lower expression levels in the spleen and the liver. SH2D1A acts as an inhibitor of the signaling lymphocyte activation molecule (SLAM) self-association. In addition, SH2D1A mediates interaction between FYN and SLAMF1. It is also thought to regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.