Recombinant Human Insulin-Like Growth Factor-Binding Protein 5/IGFBP-5

Instruction Manual!

Product name:	Recombinant Human Insulin-Like Growth Factor-Binding Protein 5/IGFBP-5
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Insulin-Like Growth Factor-Binding Protein 5 is produced by our Mammalian expression system and the target gene encoding Leu21-Glu272 is expressed with a 6His tag at the C-terminus.
Names	Insulin-Like Growth Factor-Binding Protein 5, IBP-5, IGF-Binding Protein 5, IGFBP-5, IGFBP5, IBP5
Accession #	P24593
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCALAEGQSCGVYTERCAQGLRCLPRQD EEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAE AVKKDRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMVPRAVY LPNCDRKGFYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVEVDHHHHHH
Background	Insulin-Like Growth Factor-Binding Protein 5 (IGFBP-5) is a secreted protein that belongs to the insulin-like growth factor (IGF) binding proteins superfamily. Members of this family prolong the half-life of the IGFs. They have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. IGFBP-5 contains one IGFBP N-terminal domain and one thyroglobulin type-1 domain. IGFBP-5 is expressed by fibroblasts, myoblasts and Osteosarcoma. It is also present at lower levels in liver, kidney, and brain.