Recombinant Human Fms-Related Tyrosine Kinase 3 Ligand/FLT3LG

Instruction Manual!

Product name:	Recombinant Human Fms-Related Tyrosine Kinase 3 Ligand/FLT3LG
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl，pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Fms-like Tyrosine Kinase 3 Ligand is produced by our Mammalian expression system and the target gene encoding Thr27-Pro184 is expressed with a 6His tag at the C-terminus.
Names	Fms-Felated Tyrosine Kinase 3 Ligand, Flt3 Ligand, Flt3L, SL Cytokine, FLT3LG
Accession #	P49771
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl，pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAG SKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLEL QCQPDSSTLPPPWSPRPLEATAPTAPQPVDHHHHHH
Background	Fms-Related Tyrosine Kinase 3 Ligand (FLT3LG) is a hematopoietic four helical bundle cytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors by activiation of Flt 3 receptor.